PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Thhalv10020213m
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Eutremeae; Eutrema
Family ARR-B
Protein Properties Length: 672aa    MW: 73073.6 Da    PI: 5.4852
Description ARR-B family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Thhalv10020213mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like78.86.7e-25236285151
          G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                      kpr++W+ eLH++Fv av+qL G ekA+Pk+ilelm+v+gLt+e+v+SHLQ
  Thhalv10020213m 236 KPRVVWSVELHQQFVAAVNQL-GVEKAVPKKILELMNVPGLTRENVASHLQ 285
                      79*******************.***************************** PP

2Response_reg76.11.3e-25371451109
                      EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS
     Response_reg   1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 
                      vl+vdD+p+ +++l+++l+   y ev+ +  +e al ll++++  +D+++ D+ mp+mdG++ll++   e  +lp+i+++a ++++ +l+ +  
  Thhalv10020213m  37 VLVVDDDPTCLMILERMLRTCLY-EVTKCNRAEMALSLLRKNKhgFDIVISDVHMPDMDGFKLLEHVGLEM-DLPVIMMSADDSKSVVLKGVTH 128
                      89*********************.***************888889**********************6644.8********************* PP

                      TESEEEESS--HHHHHH CS
     Response_reg  93 GakdflsKpfdpeelvk 109
                      Ga d+l Kp+ +e+l +
  Thhalv10020213m 129 GAVDYLIKPVRMEALKN 145
                      ************99986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF521726.83E-3633163IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.7E-4134174No hitNo description
SMARTSM004487.4E-3135147IPR001789Signal transduction response regulator, receiver domain
PROSITE profilePS5011042.22136151IPR001789Signal transduction response regulator, receiver domain
PfamPF000727.9E-2337145IPR001789Signal transduction response regulator, receiver domain
CDDcd001561.61E-2738150No hitNo description
SuperFamilySSF466891.79E-15234285IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.6E-24235285IPR009057Homeodomain-like
TIGRFAMsTIGR015572.7E-21236286IPR006447Myb domain, plants
PfamPF002491.4E-6238285IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0009414Biological Processresponse to water deprivation
GO:0010082Biological Processregulation of root meristem growth
GO:0010380Biological Processregulation of chlorophyll biosynthetic process
GO:0031537Biological Processregulation of anthocyanin metabolic process
GO:0048367Biological Processshoot system development
GO:0080022Biological Processprimary root development
GO:0080036Biological Processregulation of cytokinin-activated signaling pathway
GO:0080113Biological Processregulation of seed growth
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 672 aa     Download sequence    Send to blast
MMNPSHGRGL GSTGGSSSGR NQGGESVVEM FPSGLRVLVV DDDPTCLMIL ERMLRTCLYE  60
VTKCNRAEMA LSLLRKNKHG FDIVISDVHM PDMDGFKLLE HVGLEMDLPV IMMSADDSKS  120
VVLKGVTHGA VDYLIKPVRM EALKNIWQHV VRKRRSEWSV PEHSGSVEDT GERQQQQQRG  180
GGGAAVSGGE DAADDNSSSV NEGNNWRSSS SSRKRKDEEG EEQGEDKDED ASNLKKPRVV  240
WSVELHQQFV AAVNQLGVEK AVPKKILELM NVPGLTRENV ASHLQFLPGN VLLFAEISDI  300
FSTLNGFDLQ ALAVTGQLPA QSLAQLQAAG LGRPAMVSKS GLPVSSIVDE RSIFSFDNPK  360
TRFGDGLGHH GQQQQTQQMN LLHGVPTGME PRQLAGLQQQ LPVGNRMSIQ QQIAAVRAGQ  420
NTGMMMTQPF PRGPPPPVLP SSQSSSIRQQ PMLSRSGFSG RSSVPESSRV LPTSYTNLAT  480
QHSSSSMTFN NFQQELPVNS FPLPSAPGLC VPSQVRKPIS SYQEEVNSSE AGFTAPSYDM  540
FSSNRQNDWD IRSIGIAFDA HQDAESVAFS NSEAYSSSSM SRNNTASDHG RSQQQQPPPG  600
MVSNHQVYGD RSGGSVRVKA ERVATDTATM AFHDQYSNQE DLMSALLKQE GIAPVDTEFD  660
FDAYSIDDIP V*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A7e-20235285454ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3534180.0AK353418.1 Thellungiella halophila mRNA, complete cds, clone: RTFL01-42-G14.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006297106.10.0hypothetical protein CARUB_v10013107mg
SwissprotQ940D00.0ARR1_ARATH; Two-component response regulator ARR1
TrEMBLR0HK040.0R0HK04_9BRAS; Uncharacterized protein
STRINGAT3G16857.20.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24032773
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.20.0response regulator 1